PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G115800.1
Common NameB456_002G115800, LOC105783598
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Nin-like
Protein Properties Length: 926aa    MW: 102796 Da    PI: 6.7979
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G115800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.71.3e-29606657152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+i+l++l++yF++++kdAAk+Lgvc+T+LKriCRq+GIkRWP+Rkik++
  Gorai.002G115800.1 606 AEKTITLQVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGIKRWPSRKIKKV 657
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.905596677IPR003035RWP-RK domain
PfamPF020423.6E-26609657IPR003035RWP-RK domain
SuperFamilySSF542779.16E-23828915No hitNo description
PROSITE profilePS5174526.329829912IPR000270PB1 domain
SMARTSM006665.2E-28829912IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.2E-22830909No hitNo description
PfamPF005643.1E-19831911IPR000270PB1 domain
CDDcd064075.41E-41831910No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 926 aa     Download sequence    Send to blast
MEDTIFSQGT MLGGLPDSAM DFDYMDELLL DGCWLETTQG SDFLNPTLPF SNNFFDPAFT  60
WPTSESNAGD LGGGLSHQGE NQRSLLSGNS HWNEAQGESL VSPHFSQSHS LDSDCVTDGS  120
EPNRRWWIGP RVNSGPATSV MQRLIQALGY IKAFGKEKDV LVQLWLPVNR GGRRFLTTSE  180
QPFSLDPNSQ KLASYRNISV KYDFPAEEDS KDIAGLPGRV FLSKVPEWTP DVRFFKRDEY  240
PRVGHAQEHD VRGTFALPVF EQGSGTCLGV IEVVMTTEKI KIQPELESVC KALEAVNLRS  300
SITSRTQNIK AYNNCYQAAL PEIKELLRCA CETHRLPLAQ AWVPCIQQGK EGCRHSSENY  360
VHCVSTVDDA CCIADPSIQG FHEACSEHHL LKGQGVIGRA FLTNQPCFST DITSFKKTEY  420
PLAHHAMMFN LHAAVALRFR SIHTGKADFV LEFFLPAHCR DPEGQRKMLN SLSIIIQQVC  480
CSLRVVTDKE LVEETDLAVS EVVAPSDGLP IREESSKRQC TNHHSKKLSG ESSSCLTKVQ  540
KSSNTALVLE KEKPRPMLDE KLPEVEQHQQ HISLQESVEC GDSTFNEISF SSVTMGKTSE  600
KRRSKAEKTI TLQVLRQYFA GSLKDAAKSL GVCPTTLKRI CRQHGIKRWP SRKIKKVGHS  660
LQKLQHVIDS VQGASGAFHI SNFYANFPEL ASPKLLGNSA LSTSPLNDKP KQINIQPEGG  720
NFLSQAALSN SPSSSCSQSS SSSHSCSSGT HRPSNFNMSG KEDHIIGDNS GDGELKRVKS  780
DVELHASSQE GPKLFPRSQS LRSLKEQLIC DNLQPISKNT SPIAHDLEAQ RVKVTYGDEK  840
IRFRMQSKWR FKDLLHEIAR RFNIDDISRF DLKYLDDDSE WVLLTCDADM VECIDVCGSS  900
QGNTIKLSLQ VSHHHLDQFS GSTGS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464609.10.0PREDICTED: protein NLP4-like
RefseqXP_012464617.10.0PREDICTED: protein NLP4-like
RefseqXP_012464624.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A0D2M9P10.0A0A0D2M9P1_G
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]